PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0218s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 286aa    MW: 33191.3 Da    PI: 9.4054
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0218s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.83.1e-47111373128
                     NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                             pGfrFhPt+eel+++yLk+ v gk+++l +vi  ++iy+++PwdLp   + +e+ewyfF++rd+k  +g r+nr+t++g+Wkatg+d
  SapurV1A.0218s0020.1.p  11 PGFRFHPTEEELLDFYLKNIVFGKQMRL-DVIGYLNIYRHDPWDLPGLSNVGEREWYFFVPRDRKPGNGGRPNRTTQNGFWKATGSD 96 
                             9**************************9.99***************8777899********************************** PP

                     NAM  90 kevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             ++++s    ++ +gl+ktLvfykgrap+g ktdWvm+eyrl
  SapurV1A.0218s0020.1.p  97 RKIVSFsdPKRMIGLRKTLVFYKGRAPRGCKTDWVMNEYRL 137
                             ***997666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.8779156IPR003441NAC domain
SuperFamilySSF1019418.24E-5610156IPR003441NAC domain
PfamPF023651.3E-2411137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MSEMALKLDL PGFRFHPTEE ELLDFYLKNI VFGKQMRLDV IGYLNIYRHD PWDLPGLSNV  60
GEREWYFFVP RDRKPGNGGR PNRTTQNGFW KATGSDRKIV SFSDPKRMIG LRKTLVFYKG  120
RAPRGCKTDW VMNEYRLPEY SRPLPKDLVL CKIYRKATSL KVLEQRAAME DEMKTIHASP  180
SSSPPPPSLD TMPFCRLLED PVPPISLPAQ HLVFKKEIED DSNIRYEKPN EIRTPRLQLP  240
PGKDRLPELH VPSKLNMEWN QDPIWSLNSP WLLQNPALYA DILNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D9e-461116122173NAC domain-containing protein 19
3swp_C9e-461116122173NAC domain-containing protein 19
3swp_B9e-461116122173NAC domain-containing protein 19
3swp_A9e-461116122173NAC domain-containing protein 19
3swm_D9e-461116122173NAC domain-containing protein 19
3swm_C9e-461116122173NAC domain-containing protein 19
3swm_B9e-461116122173NAC domain-containing protein 19
3swm_A9e-461116122173NAC domain-containing protein 19
4dul_B1e-451116119170NAC domain-containing protein 19
4dul_A1e-451116119170NAC domain-containing protein 19
1ut7_B1e-451116119170NO APICAL MERISTEM PROTEIN
1ut7_A1e-451116119170NO APICAL MERISTEM PROTEIN
1ut4_B1e-451116119170NO APICAL MERISTEM PROTEIN
1ut4_A1e-451116119170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2248830.0CU224883.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313680.11e-178no apical meristem family protein
TrEMBLB9HQZ31e-178B9HQZ3_POPTR; No apical meristem family protein
STRINGPOPTR_0009s14370.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-100NAC domain containing protein 36